• DRAMP ID

    • DRAMP02891
    • Peptide Name

    • Tracheal antimicrobial peptide
    • Source

    • Bos taurus (Bovine)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • WSGFTQGVGNPVSCVRNKGICVPIRCPGNMKQIGTC
    • Sequence Length

    • 36
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02891 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02891.
    • Formula

    • C162H264N50O46S5
    • Absent Amino Acids

    • ADEHLY
    • Common Amino Acids

    • G
    • Mass

    • 3808.49
    • PI

    • 9.31
    • Basic Residues

    • 4
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +4
    • Boman Index

    • -34.54
    • Hydrophobicity

    • -0.011
    • Aliphatic Index

    • 64.72
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5750
    • Absorbance 280nm

    • 164.29
    • Polar Residues

    • 17

DRAMP02891

DRAMP02891 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Expression of tracheal antimicrobial peptide in bovine mammary epithelial cells.
    • Reference

    • Res Vet Sci. 2009 Aug;87(1):59-63.
    • Author

    • López-Meza JE, Gutiérrez-Barroso A, Ochoa-Zarzosa A.