General Information

    • DRAMP ID

    • DRAMP02891

    • Peptide Name

    • Tracheal antimicrobial peptide

    • Source

    • Bos taurus (Bovine)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • WSGFTQGVGNPVSCVRNKGICVPIRCPGNMKQIGTC

    • Sequence Length

    • 36

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02891 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02891.

Physicochemical Information

    • Formula

    • C162H264N50O46S5

    • Absent Amino Acids

    • ADEHLY

    • Common Amino Acids

    • G

    • Mass

    • 3808.49

    • PI

    • 9.31

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +4

    • Boman Index

    • -34.54

    • Hydrophobicity

    • -0.011

    • Aliphatic Index

    • 64.72

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 164.29

    • Polar Residues

    • 17

DRAMP02891

DRAMP02891 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Expression of tracheal antimicrobial peptide in bovine mammary epithelial cells.

    • Reference

    • Res Vet Sci. 2009 Aug;87(1):59-63.

    • Author

    • López-Meza JE, Gutiérrez-Barroso A, Ochoa-Zarzosa A.