General Information

    • DRAMP ID

    • DRAMP02893

    • Peptide Name

    • Hepcidin antimicrobial peptide 2

    • Source

    • Pagrus auriga

    • Family

    • Not found

    • Gene

    • HAMP2

    • Sequence

    • MKTFSVAVAVAVVLTFICLQESSADSVTEVQELEEPMSIGSPVAAYEEMPEESWKMPYASRSSSDRRRRRWRCRTCCRCCPRMKGCGICCRRR

    • Sequence Length

    • 93

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02893 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02893.

Physicochemical Information

    • Formula

    • C446H729N139O135S14

    • Absent Amino Acids

    • HN

    • Common Amino Acids

    • R

    • Mass

    • 10647.39

    • PI

    • 8.84

    • Basic Residues

    • 16

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 25

    • Net Charge

    • +5

    • Boman Index

    • -237.16

    • Hydrophobicity

    • -0.346

    • Aliphatic Index

    • 57.63

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14480

    • Absorbance 280nm

    • 157.39

    • Polar Residues

    • 29

DRAMP02893

DRAMP02893 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Genomic characterization and gene expression analysis of four hepcidin genes in the redbanded seabream (Pagrus auriga).

    • Reference

    • Fish Shellfish Immunol. 2009,26:483-491.

    • Author

    • Martin-Antonio B, Jimenez-Cantizano RM, Salas-Leiton E, Infante C, Manchado M.