General Information

    • DRAMP ID

    • DRAMP02895

    • Peptide Name

    • Hepcidin antimicrobial peptide 4

    • Source

    • Pagrus auriga

    • Family

    • Not found

    • Gene

    • HAMP4

    • Sequence

    • MKTFSVAVAVAVVLTFICLQESSAVSFTEVQEQEEPMSNDSPVAAHEEMSEESWKMPYNNRHKRSPAGRNKRRRRCRFCCGCCPNMIGCGTCCKF

    • Sequence Length

    • 95

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02895 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02895.

Physicochemical Information

    • Formula

    • C452H719N137O138S14

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • CESRV

    • Mass

    • 10729.36

    • PI

    • 8.42

    • Basic Residues

    • 15

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 25

    • Net Charge

    • +5

    • Boman Index

    • -208.35

    • Hydrophobicity

    • -0.399

    • Aliphatic Index

    • 48.21

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 79.68

    • Polar Residues

    • 32

DRAMP02895

DRAMP02895 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Genomic characterization and gene expression analysis of four hepcidin genes in the redbanded seabream (Pagrus auriga).

    • Reference

    • Fish Shellfish Immunol. 2009,26:483-491.

    • Author

    • Martin-Antonio B, Jimenez-Cantizano RM, Salas-Leiton E, Infante C, Manchado M.