General Information

    • DRAMP ID

    • DRAMP02896

    • Peptide Name

    • Brevinin-1-AJ1 antimicrobial peptide

    • Source

    • Amolops jingdongensis (Chinese torrent frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTLKKSLLLLFFLGTINLSLCEQERNADEEERRDDSDKRDVEVEKRFLSTLLKVAFKVVPTLFCPITKKC

    • Sequence Length

    • 71

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • [Ref.22828809] 7.62% hemolytic activity at 25 μg/ml,24.58% hemolytic activity at 50 μg/ml, 83.05% hemolytic activity at 100 μg/ml, 87.65% hemolytic activity at 200 μg/ml against rabbit red blood cells

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys65 and Cys71)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys65 and Cys71.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02896 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02896.

Physicochemical Information

    • Formula

    • C373H611N97O108S4

    • Absent Amino Acids

    • HWY

    • Common Amino Acids

    • L

    • Mass

    • 8310.78

    • PI

    • 7.68

    • Basic Residues

    • 13

    • Acidic Residues

    • 12

    • Hydrophobic Residues

    • 27

    • Net Charge

    • +1

    • Boman Index

    • -137.83

    • Hydrophobicity

    • -0.156

    • Aliphatic Index

    • 100.14

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 1.79

    • Polar Residues

    • 15

DRAMP02896

DRAMP02896 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptide diversity in the skin of the torrent frog, Amolops jingdongensis.

    • Reference

    • Amino Acids. 2012 Jul 25

    • Author

    • He X, Yang S, Wei L, Liu R, Lai R, Rong M.