• DRAMP ID

    • DRAMP02897
    • Peptide Name

    • Brevinin-1-AJ2 antimicrobial peptide
    • Source

    • Amolops jingdongensis (Chinese torrent frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTLKKSLLLLFFLGTINLFFCEQERDADEEERRDDDEMDVEVEKRFLPLAVSLAANFLPKLFCKITKKC
    • Sequence Length

    • 70
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02897 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02897.
    • Formula

    • C375H594N92O107S5
    • Absent Amino Acids

    • HWY
    • Common Amino Acids

    • L
    • Mass

    • 8263.69
    • PI

    • 4.88
    • Basic Residues

    • 11
    • Acidic Residues

    • 14
    • Hydrophobic Residues

    • 29
    • Net Charge

    • -3
    • Boman Index

    • -117.1
    • Hydrophobicity

    • -0.057
    • Aliphatic Index

    • 96.14
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 1.81
    • Polar Residues

    • 11

DRAMP02897

DRAMP02897 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Antimicrobial peptide diversity in the skin of the torrent frog, Amolops jingdongensis.
    • Reference

    • Amino Acids. 2012 Jul 25
    • Author

    • He X, Yang S, Wei L, Liu R, Lai R, Rong M.