• DRAMP ID

    • DRAMP02900
    • Peptide Name

    • Brevinin-1MT2 antimicrobial peptide
    • Source

    • Amolops mantzorum
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTLKKSMLLLFFLGTINLSLCEQERNADEEERRDDDEMDVEVEKRFLPMLAGLAANFLPKLFCKITKKC
    • Sequence Length

    • 70
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02900 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02900.
    • Formula

    • C364H589N93O106S7
    • Absent Amino Acids

    • HWY
    • Common Amino Acids

    • L
    • Mass

    • 8188.66
    • PI

    • 5.07
    • Basic Residues

    • 11
    • Acidic Residues

    • 13
    • Hydrophobic Residues

    • 26
    • Net Charge

    • -2
    • Boman Index

    • -119.38
    • Hydrophobicity

    • -0.149
    • Aliphatic Index

    • 92
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 1.81
    • Polar Residues

    • 13

DRAMP02900

DRAMP02900 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Antimicrobial peptides from amphibian skin of Amolops mantzorum.
    • Reference

    • Submitted (AUG-2010) to the EMBL/GenBank/DDBJ database
    • Author

    • Wang H, Liu J.