General Information

    • DRAMP ID

    • DRAMP02904

    • Peptide Name

    • Antibacterial substance A

    • Source

    • Streptomyces carzinostaticus

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • AAGNPSETGGAVATYSTAVGSFLDGTVKVVATGGASRVPGNCGTAAVLECDNPESFDGTRAWGDLSADQGTGEDAPPETASLIFAVN

    • Sequence Length

    • 87

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02904 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02904.

Physicochemical Information

    • Formula

    • C361H560N100O132S2

    • Absent Amino Acids

    • HM

    • Common Amino Acids

    • AG

    • Mass

    • 8477.13

    • PI

    • 3.85

    • Basic Residues

    • 3

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 31

    • Net Charge

    • -8

    • Boman Index

    • -92.62

    • Hydrophobicity

    • -0.049

    • Aliphatic Index

    • 65.17

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 82.73

    • Polar Residues

    • 36

DRAMP02904

DRAMP02904 chydropathy plot

Comments Information

    • Function

    • May have antibacterial activity.

    • PTM

    • Contains one disulfide bond 42-50.

Literature Information

  • ·Literature 1

    • Title

    • The total amino acid sequence of substance A produced by Streptomyces carzinostaticus.

    • Reference

    • Chem Pharm Bull (Tokyo). 1969 Oct;17(10):2188-2191.

    • Author

    • Sato H, Tanimura T, Nakajima T, Tamura Z.