General Information

    • DRAMP ID

    • DRAMP02905

    • Peptide Name

    • Hinnavin II

    • Source

    • Artogeia rapae

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG

    • Sequence Length

    • 38

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02905 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02905.

Physicochemical Information

    • Formula

    • C192H314N54O49S

    • Absent Amino Acids

    • CS

    • Common Amino Acids

    • K

    • Mass

    • 4195

    • PI

    • 10.12

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +6

    • Boman Index

    • -33.14

    • Hydrophobicity

    • -0.205

    • Aliphatic Index

    • 95

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 188.92

    • Polar Residues

    • 8

DRAMP02905

DRAMP02905 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterization and cDNA cloning of hinnavin II, a cecropin family antibacterial peptide from the cabbage butterfly, Artogeia rapae.

    • Reference

    • Comp Biochem Physiol B Biochem Mol Biol. 2006 Jun;144(2):199-205.

    • Author

    • Yoe SM, Kang CS, Han SS, Bang IS.