General Information

    • DRAMP ID

    • DRAMP02908

    • Peptide Name

    • Beta-defensin 1 (BD-1; sBD-1; mammals, animals)

    • Source

    • Ovis aries (Sheep)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB1

    • Sequence

    • QGVRNRLSCHRNKGVCVPSRCPRHMRQIGTCRGPPVKCCRKK

    • Sequence Length

    • 42

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02908 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02908.

Physicochemical Information

    • Formula

    • C195H342N78O50S7

    • Absent Amino Acids

    • ADEFWY

    • Common Amino Acids

    • R

    • Mass

    • 4803.77

    • PI

    • 11.26

    • Basic Residues

    • 14

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +14

    • Boman Index

    • -144.82

    • Hydrophobicity

    • -0.96

    • Aliphatic Index

    • 46.19

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 9.15

    • Polar Residues

    • 15

DRAMP02908

DRAMP02908 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptide expression is developmentally regulated in the ovine gastrointestinal tract.

    • Reference

    • J Nutr. 1998 Feb;128(2 Suppl):297S-299S.

    • Author

    • Huttner K.M, Brezinski-Caliguri D.J, Mahoney M.M, Diamond G.
  • ·Literature 2

    • Title

    • Localization and genomic organization of sheep antimicrobial peptides genes.

    • Reference

    • Gene. 1998 Jan 5;206(1):85-91.

    • Author

    • Huttner K.M, Lambeth M.R, Burkin H.R, Broad T.E.