General Information

    • DRAMP ID

    • DRAMP02916

    • Peptide Name

    • OaBac6

    • Source

    • Ovis aries (Sheep)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RRLRPRHQHFPSERPWPKPLPLPLPRPGPRPWPKPLPLPLPRPGLRPWPKPL

    • Sequence Length

    • 52

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02916 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02916.

Physicochemical Information

    • Formula

    • C297H464N90O57

    • Absent Amino Acids

    • ACDIMNTVY

    • Common Amino Acids

    • P

    • Mass

    • 6207.52

    • PI

    • 12.55

    • Basic Residues

    • 14

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +13

    • Boman Index

    • -119.87

    • Hydrophobicity

    • -1.248

    • Aliphatic Index

    • 67.5

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 16500

    • Absorbance 280nm

    • 323.53

    • Polar Residues

    • 3

DRAMP02916

DRAMP02916 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterisation of proline/arginine-rich cathelicidin peptides from ovine neutrophils.

    • Reference

    • Biochem Biophys Res Commun. 2003 Dec 26;312(4):1139-1146.

    • Author

    • Anderson RC, Yu PL.