• DRAMP ID

    • DRAMP02918
    • Peptide Name

    • Beta-defensin 1
    • Source

    • Canis familiaris (Dog) (Canis lupus familiaris)
    • Family

    • Not found
    • Gene

    • CBD1
    • Sequence

    • MRPLYLLLLLLCLLFSYLPPGAGFLTGIGQRSDQYICARKGGTCNFSPCPLFTRIDGTCYRGKAKCCMP
    • Sequence Length

    • 69
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02918 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02918.
    • Formula

    • C343H544N90O88S9
    • Absent Amino Acids

    • EHVW
    • Common Amino Acids

    • L
    • Mass

    • 7625.18
    • PI

    • 9.16
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 22
    • Net Charge

    • +6
    • Boman Index

    • -35.12
    • Hydrophobicity

    • 0.32
    • Aliphatic Index

    • 89.13
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 6335
    • Absorbance 280nm

    • 93.16
    • Polar Residues

    • 27

DRAMP02918

DRAMP02918 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.