• DRAMP ID

    • DRAMP02920
    • Peptide Name

    • Beta-defensin 119 (Defensin, beta 119; dogs, mammals, animals)
    • Source

    • Canis familiaris (Dog)
    • Family

    • Belongs to the glycosyl hydrolase 22 family
    • Gene

    • DEFB119
    • Sequence

    • KHHILRCMGNTGICRPSCRKTEQPYLYCLNYQSCCLQSYMRISISGREEKDDWSQQNRWPKIS
    • Sequence Length

    • 63
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C322H507N99O95S8
    • Absent Amino Acids

    • AFV
    • Common Amino Acids

    • SCR
    • Mass

    • 7541.65
    • PI

    • 9.06
    • Basic Residues

    • 12
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +7
    • Boman Index

    • -171.89
    • Hydrophobicity

    • -0.921
    • Aliphatic Index

    • 55.71
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 17335
    • Absorbance 280nm

    • 279.6
    • Polar Residues

    • 25

DRAMP02920

DRAMP02920 chydropathy plot
    • Function

    • Has antibacterial activity (By similarity).
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.