General Information

    • DRAMP ID

    • DRAMP02921

    • Peptide Name

    • Beta-defensin 138

    • Source

    • Canis familiaris (Dog) (Canis lupus familiaris)

    • Family

    • Not found

    • Gene

    • CBD138

    • Sequence

    • MRLLFLLFLLLVCLVQMTSGREKRRKSLECERMGGVCKHQKTHGCSILPAECKSRNKHCCRV

    • Sequence Length

    • 62

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02921 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02921.

Physicochemical Information

    • Formula

    • C306H524N98O80S10

    • Absent Amino Acids

    • DWY

    • Common Amino Acids

    • L

    • Mass

    • 7176.74

    • PI

    • 9.72

    • Basic Residues

    • 16

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +12

    • Boman Index

    • -117.6

    • Hydrophobicity

    • -0.111

    • Aliphatic Index

    • 89.52

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 6.15

    • Polar Residues

    • 18

DRAMP02921

DRAMP02921 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.