• • DRAMP ID

  • DRAMP02923

• • Peptide Name

  • cBD-1 (Canine beta-defensin 1; dogs, mammals, animals)

• • Source

  • Canis Lupis (Dog)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • KCWNLRGSCREKCIKNEKLYIFCTSGKLCCLKPKFQPNMLQR

• • Sequence Length

  • 42

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-positive bacteria: Listeria monocytogenes(MIC=6 mµg/ml), Staphylococcus aureus (MIC=100 mµg/ml);
    • Gram-negative bacteria: Escherichia coli (MIC=20-25 mµg/ml), Klebsiella pneumoniae (MIC=20 mµg/ml), Neisseria gonorrhoeae (MIC=50 mµg/ml).
    • Yeast: Candida albicans (MIC=5-50 mµg/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP02923.

DRAMP02923

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • Molecular cloning and characterization of three beta-defensins from canine testes.

• • Pubmed ID

  • 15845463

• • Reference

  • Infect Immun. 2005 May;73(5):2611-2620.

• • Author

  • Sang Y, Ortega MT, Blecha F, Prakash O, Melgarejo T.