General Information

    • DRAMP ID

    • DRAMP02936

    • Peptide Name

    • Big defensin (crabs, Arthropods, animals)

    • Source

    • Tachypleus tridentatus (Japanese horseshoe crab)

    • Family

    • Belongs to the big defensin family

    • Gene

    • Not found

    • Sequence

    • NPLIPAIYIGATVGPSVWAYLVALVGAAAVTAANIRRASSDNHSCAGNRGWCRSKCFRHEYVDTYYSAVCGRYFCCRSR

    • Sequence Length

    • 79

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli 09:K39 (IC50=5 µg/ml), Salmonella typhimurium LT2 (IC50=20 µg/ml), S. minnesota R595 (IC50=1.3 µg/ml), Klebsiella pneumoniae (IC50>10 µg/ml);
      • Gram-positive bacteria: Staphylococcus aureus (IC50<2.5 µg/ml).
      • Yeast: Candida albicans (IC50>20 µg/ml)(Ref.1).
      • Note: Washed with a phosphate buffered saline (PBS, pH 7.0).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipopolysaccharide (LPS)-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02936 helical wheel diagram

    • PDB ID

    • 2RNG resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP02936.

Physicochemical Information

    • Formula

    • C380H582N114O106S6

    • Absent Amino Acids

    • MQ

    • Common Amino Acids

    • A

    • Mass

    • 8635.86

    • PI

    • 9.27

    • Basic Residues

    • 11

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 30

    • Net Charge

    • +8

    • Boman Index

    • -109.01

    • Hydrophobicity

    • 0.072

    • Aliphatic Index

    • 75.44

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 20315

    • Absorbance 280nm

    • 260.45

    • Polar Residues

    • 32

DRAMP02936

DRAMP02936 chydropathy plot

Comments Information

    • Function

    • Significantly inhibits the growth of Gram-negative and Gram-positive bacteria and fungi in vitro.

    • Tissue specificity

    • Expressed in all tissues examined, including hemocytes, heart, hepatopancreas, stomach, intestine and skeletal muscle.

    • PTM

    • Contains three disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • A novel big defensin identified in horseshoe crab hemocytes: isolation, amino acid sequence, and antibacterial activity.

    • Reference

    • J Biochem. 1995 May;117(5):1131-1137.

    • Author

    • Saito T, Kawabata S, Shigenaga T, Takayenoki Y, Cho J, Nakajima H, Hirata M, Iwanaga S.
  • ·Literature 2

    • Title

    • A novel beta-defensin structure: a potential strategy of big defensin for overcoming resistance by Gram-positive bacteria.

    • Reference

    • Biochemistry. 2008 Oct 7;47(40):10611-9.

    • Author

    • Kouno T, Fujitani N, Mizuguchi M, Osaki T, Nishimura S, Kawabata S, Aizawa T, Demura M, Nitta K, Kawano K.