General Information

    • DRAMP ID

    • DRAMP02937

    • Peptide Name

    • Tachycitin (crabs, Arthropods, animals)

    • Source

    • Tachypleus tridentatus (Japanese horseshoe crab)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • YLAFRCGRYSPCLDDGPNVNLYSCCSFYNCHKCLARLENCPKGLHYNAYLKVCDWPSKAGCTSVNKECHLWKT

    • Sequence Length

    • 73

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus (IC50=56 µg/ml);
      • Gram-negative bacteria: Escherichia coli 363 (IC50=33 µg/ml), Escherichia coli B (IC50=2 µg/ml), Salmonella typhimurium LT2 (IC50=44 µg/ml), S. minnesota R595 (IC50=41 µg/ml), Klebsiella pneumoniae (IC50=32 µg/ml).
      • Yeast: Candida albicans (IC50=52 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Beta strand

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02937 helical wheel diagram

    • PDB ID

    • 1DQC resolved by NMR.
  • 1DQC-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP02937.

Physicochemical Information

    • Formula

    • C368H552N102O103S10

    • Absent Amino Acids

    • IMQ

    • Common Amino Acids

    • C

    • Mass

    • 8373.65

    • PI

    • 8.56

    • Basic Residues

    • 12

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +7

    • Boman Index

    • -108.74

    • Hydrophobicity

    • -0.373

    • Aliphatic Index

    • 60.14

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 20565

    • Absorbance 280nm

    • 285.63

    • Polar Residues

    • 33

DRAMP02937

DRAMP02937 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Tachycitin, a small granular component in horseshoe crab hemocytes, is an antimicrobial protein with chitin-binding activity.

    • Reference

    • J Biochem. 1996 Dec;120(6):1253-1260.

    • Author

    • Kawabata S, Nagayama R, Hirata M, Shigenaga T, Agarwala KL, Saito T, Cho J, Nakajima H, Takagi T, Iwanaga S.
  • ·Literature 2

    • Title

    • Chitin-binding proteins in invertebrates and plants comprise a common chitin-binding structural motif.

    • Reference

    • J Biol Chem. 2000 Jun 16;275(24):17929-17932.

    • Author

    • Suetake T, Tsuda S, Kawabata S, Miura K, Iwanaga S, Hikichi K, Nitta K, Kawano K.