General Information

    • DRAMP ID

    • DRAMP02941

    • Peptide Name

    • Tachystatin-A1 (crabs, Arthropods, animals)

    • Source

    • Tachypleus tridentatus (Japanese horseshoe crab)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (IC50=25 µg/ml);
      • Gram-positive bacterium: Staphylococcus aureus (IC50=4.2 µg/ml).
      • Fungi: Candida albicans (IC50=3.0 µg/ml), Pichia pastoris (IC50=0.5 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02941 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02941.

Physicochemical Information

    • Formula

    • C219H336N66O60S6

    • Absent Amino Acids

    • ADEHKMW

    • Common Amino Acids

    • CR

    • Mass

    • 5045.84

    • PI

    • 9.38

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -85.57

    • Hydrophobicity

    • -0.241

    • Aliphatic Index

    • 48.64

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6335

    • Absorbance 280nm

    • 147.33

    • Polar Residues

    • 23

DRAMP02941

DRAMP02941 chydropathy plot

Comments Information

    • Function

    • Exhibits stronger antimicrobial activity against the Gram-positive bacterium S. aureus and fungi C. albicans and P. pastoris than Gram-negative bacterium E. coli. Binds to chitin (8.4 µM are required to obtain 50% of binding). Does not cause hemolysis on sheep erythrocytes. Has no blocking activity on the P-type calcium channel.

    • Tissue specificity

    • Granular hemocytes, small secretory granules.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins.

    • Reference

    • J Biol Chem. 1999 Sep 10;274(37):26172-26178.

    • Author

    • Osaki T, Omotezako M, Nagayama R, Hirata M, Iwanaga S, Kasahara J, Hattori J, Ito I, Sugiyama H, Kawabata S.