General Information

    • DRAMP ID

    • DRAMP02945

    • Peptide Name

    • Tachystatin-C (crabs, Arthropods, animals)

    • Source

    • Tachypleus tridentatus (Japanese horseshoe crab)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DYDWSLRGPPKCATYGQKCRTWSPPNCCWNLRCKAFRCRPR

    • Sequence Length

    • 41

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (IC50=1.2 µg/ml);
      • Gram-positive bacterium: Staphylococcus aureus (IC50=0.8 µg/ml).
      • Fungi: Candida albicans (IC50=0.9 µg/ml), Pichia pastoris (IC50=0.3 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02945 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02945.

Physicochemical Information

    • Formula

    • C214H324N68O55S6

    • Absent Amino Acids

    • EHIMV

    • Common Amino Acids

    • CR

    • Mass

    • 4921.71

    • PI

    • 9.55

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +7

    • Boman Index

    • -121.66

    • Hydrophobicity

    • -1.081

    • Aliphatic Index

    • 23.9

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 19855

    • Absorbance 280nm

    • 496.38

    • Polar Residues

    • 16

DRAMP02945

DRAMP02945 chydropathy plot

Comments Information

    • Causes hemolysis on sheep erythrocytes, probably by forming ion-permeable pores.

Literature Information

  • ·Literature 1

    • Title

    • Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins.

    • Reference

    • J Biol Chem. 1999 Sep 10;274(37):26172-26178.

    • Author

    • Osaki T, Omotezako M, Nagayama R, Hirata M, Iwanaga S, Kasahara J, Hattori J, Ito I, Sugiyama H, Kawabata S.