General Information

    • DRAMP ID

    • DRAMP02946

    • Peptide Name

    • PtALF1 (Portunus trituberculatus anti-lipopolysaccharide factor isoform 1; crabs, Arthropods, ani

    • Source

    • Portunus trituberculatus (Swimming Crab)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • YEALVTSILGKLTGLWHNDSVDFMGHICYFRRRPKIRRFKLYHEGKFWCPGWAPFEGRCKYCVVF

    • Sequence Length

    • 65

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipopolysaccharide (LPS)-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02946 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02946.

Physicochemical Information

    • Formula

    • C366H538N98O85S5

    • Absent Amino Acids

    • Q

    • Common Amino Acids

    • FGRKL

    • Mass

    • 7831.2

    • PI

    • 9.46

    • Basic Residues

    • 14

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +9

    • Boman Index

    • -91.14

    • Hydrophobicity

    • -0.209

    • Aliphatic Index

    • 68.92

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 22710

    • Absorbance 280nm

    • 354.84

    • Polar Residues

    • 19

DRAMP02946

DRAMP02946 chydropathy plot

Comments Information

    • Contains a signal peptide and an LPS-binding Domain

    • (CYFRRRPKIRRFKLYHEGKFWC) and two conserved cysteine residues which can form a disulfide bridge.

Literature Information

  • ·Literature 1

    • Title

    • Three isoforms of anti-lipopolysaccharide factor identified from eyestalk cDNA library of swimming crab Portunus trituberculatus.

    • Reference

    • Fish Shellfish Immunol. 2011 Feb;30(2):583-591.

    • Author

    • Liu Y, Cui Z, Luan W, Song C, Nie Q, Wang S, Li Q.