General Information

    • DRAMP ID

    • DRAMP02949

    • Peptide Name

    • PtALF4 (Portunus trituberculatus anti-lipopolysaccharide factor isoform 4; crabs, Arthropods, ani

    • Source

    • Portunus trituberculatus (Swimming Crab)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GWLDIVKAIVVPAARETIKTQEITLLDHYCTLSRSPYIKSLELHYRAEVTCPGWTIIRGRGSNHRNPTNSGKDALKDFMTQAVAAGLVTKEEAAPWLN

    • Sequence Length

    • 98

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipopolysaccharide (LPS)-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02949 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02949.

Physicochemical Information

    • Formula

    • C486H775N137O142S3

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • ALT

    • Mass

    • 10905.51

    • PI

    • 8.68

    • Basic Residues

    • 15

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 36

    • Net Charge

    • +5

    • Boman Index

    • -149.15

    • Hydrophobicity

    • -0.252

    • Aliphatic Index

    • 91.63

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 21095

    • Absorbance 280nm

    • 217.47

    • Polar Residues

    • 29

DRAMP02949

DRAMP02949 chydropathy plot

Comments Information

    • Contains a signal peptide and an LPS-binding Domain

    • (CTLSRSPYIKSLELHYRAEVTC) and two conserved cysteine residues which can form a disulfide bridge.

Literature Information

  • ·Literature 1

    • Title

    • Multiple isoforms of immune-related genes from hemocytes and eyestalk cDNA libraries of swimming crab Portunus trituberculatus.

    • Reference

    • Fish Shellfish Immunol. 2011 Jul;31(1):29-42.

    • Author

    • Liu Y, Cui Z, Song C, Wang S, Li Q.
  • ·Literature 2

    • Title

    • A new anti-lipopolysaccharide factor isoform (PtALF4) from the swimming crab Portunus trituberculatus exhibited structural and functional diversity of ALFs.

    • Reference

    • Fish Shellfish Immunol. 2012 May;32(5):724-731.

    • Author

    • Liu Y, Cui Z, Li X, Song C, Li Q, Wang S.