General Information

    • DRAMP ID

    • DRAMP02951

    • Peptide Name

    • PtALF6 (Portunus trituberculatus anti-lipopolysaccharide factor isoform 6; crabs, Arthropods, ani

    • Source

    • Portunus trituberculatus (Swimming Crab)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MARVSLLLIVLSIALVAPSQGFLKDLLFGEAKTALLEDGTTEILDHVCNFRVMPRLRSWELYFRGDVWCPGWTVIKGESL

    • Sequence Length

    • 80

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacteria: Vibrio alginolyticus L59 (MIC=1.17-2.33 µM), Pseudomonas aeruginosa P25 (MIC=9.32-18.64 µM);
      • Gram-positive bacteria: Micrococcus luteus M2 (MIC=9.32-18.64 µM), Staphylococcus aureus S7 (MIC=9.32-18.64 µM).
      • Fungi: Pichia pastoris GS115 (MIC>74.57 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipopolysaccharide (LPS)-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02951 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02951.

Physicochemical Information

    • Formula

    • C414H655N105O111S4

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • L

    • Mass

    • 9007.63

    • PI

    • 5.68

    • Basic Residues

    • 9

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 37

    • Net Charge

    • 0

    • Boman Index

    • -46.74

    • Hydrophobicity

    • 0.446

    • Aliphatic Index

    • 119.38

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18115

    • Absorbance 280nm

    • 229.3

    • Polar Residues

    • 19

DRAMP02951

DRAMP02951 chydropathy plot

Comments Information

    • Contains a signal peptide and an LPS-binding Domain

    • (CNFPVMPRLRSWELYFRGDVWC) and two conserved cysteine residues which can form a disulfide bridge.

Literature Information

  • ·Literature 1

    • Title

    • Multiple isoforms of immune-related genes from hemocytes and eyestalk cDNA libraries of swimming crab Portunus trituberculatus.

    • Reference

    • Fish Shellfish Immunol. 2011 Jul;31(1):29-42.

    • Author

    • Liu Y, Cui Z, Song C, Wang S, Li Q.
  • ·Literature 2

    • Title

    • A newly identified anti-lipopolysaccharide factor from the swimming crab Portunus trituberculatus with broad spectrum antimicrobial activity.

    • Reference

    • Fish Shellfish Immunol. 2013 Feb;34(2):463-470.

    • Author

    • Liu Y, Cui Z, Li X, Song C, Shi G.