General Information

    • DRAMP ID

    • DRAMP02952

    • Peptide Name

    • PtALF7 (Portunus trituberculatus anti-lipopolysaccharide factor isoform 7; crabs, Arthropods, ani

    • Source

    • Portunus trituberculatus (Swimming Crab)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MRKGVVTGLFVALVVMCLYLPQPCEAQYEALTAAILTKLSKMWHSDTLNFLGHTCHVSRTPTVKRFKLYWKGKFWCPGWA

    • Sequence Length

    • 80

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Vibrio alginolyticus (MIC=0.51-1.02 µM), Edwardsiella tarda (MIC=2.04-4.07 µM), Pseudomonas aeruginosa (MIC=1.02-2.04 µM);
      • Gram-positive bacteria: Micrococcus luteus (MIC=32.59-65.19 µM), Staphylococcus aureus (MIC=8.15-16.30 µM).
      • Fungi: Pichia pastoris (MIC>130.37 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipopolysaccharide (LPS)-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02952 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02952.

Physicochemical Information

    • Formula

    • C426H655N109O103S7

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • L

    • Mass

    • 9175.98

    • PI

    • 9.59

    • Basic Residues

    • 13

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 32

    • Net Charge

    • +10

    • Boman Index

    • -34.89

    • Hydrophobicity

    • 0.188

    • Aliphatic Index

    • 86.5

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 26720

    • Absorbance 280nm

    • 338.23

    • Polar Residues

    • 23

DRAMP02952

DRAMP02952 chydropathy plot

Comments Information

    • Contains a signal peptide and an LPS-binding Domain

    • (CHVSRTPTVKRFKLYWKGKFWC) and two conserved cysteine residues which can form a disulfide bridge.

Literature Information

  • ·Literature 1

    • Title

    • Multiple isoforms of immune-related genes from hemocytes and eyestalk cDNA libraries of swimming crab Portunus trituberculatus.

    • Reference

    • Fish Shellfish Immunol. 2011 Jul;31(1):29-42.

    • Author

    • Liu Y, Cui Z, Song C, Wang S, Li Q.
  • ·Literature 2

    • Title

    • Molecular cloning, genomic structure and antimicrobial activity of PtALF7, a unique isoform of anti-lipopolysaccharide factor from the swimming crab Portunus trituberculatus.

    • Reference

    • Fish Shellfish Immunol. 2013 Feb;34(2):652-659.

    • Author

    • Liu Y, Cui Z, Li X, Song C, Shi G, Wang C.