General Information
-
DRAMP ID
- DRAMP02954
-
Peptide Name
- Arasin 2 (Pro-rich, Arg-rich; crabs, Arthropods, animals)
-
Source
- Hyas araneus (Great spider crab)
-
Family
- Not found
-
Gene
- Not found
-
Sequence
- SRWPSPGRPRPFPGRPNPIFRPRPCICVRQPCPCDTY
-
Sequence Length
- 37
-
UniProt Entry
- A6XMY1
-
Protein Existence
- Predicted
Activity Information
-
Biological Activity
- Antimicrobial, Antibacterial
-
Target Organism
- No MICs found in DRAMP database
-
Hemolytic Activity
-
- No hemolysis information or data found in the reference(s) presented in this entry
-
Cytotoxicity
-
- Not included yet
-
Binding Target
- Not found
Structure Information
-
Linear/Cyclic
- Not included yet
-
N-terminal Modification
- Not included yet
-
C-terminal Modification
- Not included yet
-
Nonterminal Modifications and Unusual Amino Acids
- Not included yet
-
Stereochemistry
- Not included yet
-
Structure
- Not found
-
Structure Description
- Not found
-
Helical Wheel Diagram
-
PDB ID
- None
-
Predicted Structure
- There is no predicted structure for DRAMP02954.
Physicochemical Information
-
Formula
- C191H293N61O46S4
Absent Amino Acids
- AEHKLM
Common Amino Acids
- P
Mass
- 4308.05
PI
- 10.63
Basic Residues
- 7
Acidic Residues
- 1
Hydrophobic Residues
- 6
Net Charge
- +6
-
Boman Index
- -105.68
Hydrophobicity
- -0.976
Aliphatic Index
- 28.92
Half Life
-
- Mammalian:1.9 hour
- Yeast:>20 hour
- E.coli:>10 hour
Extinction Coefficient Cystines
- 7240
Absorbance 280nm
- 201.11
Polar Residues
- 11
DRAMP02954
Comments Information
Comment
- No comments found on DRAMP database
Literature Information
- ·Literature 1
-
Title
- Arasin 1, a proline-arginine-rich antimicrobial peptide isolated from the spider crab, Hyas araneus.
-
Pubmed ID
- 17658600
-
Reference
- Dev Comp Immunol. 2008;32(3):275-285.
-
Author
- Stensvåg K, Haug T, Sperstad SV, Rekdal O, Indrevoll B, Styrvold OB.
