General Information

    • DRAMP ID

    • DRAMP02954

    • Peptide Name

    • Arasin 2 (Pro-rich, Arg-rich; crabs, Arthropods, animals)

    • Source

    • Hyas araneus (Great spider crab)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SRWPSPGRPRPFPGRPNPIFRPRPCICVRQPCPCDTY

    • Sequence Length

    • 37

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02954 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02954.

Physicochemical Information

    • Formula

    • C191H293N61O46S4

    • Absent Amino Acids

    • AEHKLM

    • Common Amino Acids

    • P

    • Mass

    • 4308.05

    • PI

    • 10.63

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +6

    • Boman Index

    • -105.68

    • Hydrophobicity

    • -0.976

    • Aliphatic Index

    • 28.92

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7240

    • Absorbance 280nm

    • 201.11

    • Polar Residues

    • 11

DRAMP02954

DRAMP02954 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Arasin 1, a proline-arginine-rich antimicrobial peptide isolated from the spider crab, Hyas araneus.

    • Reference

    • Dev Comp Immunol. 2008;32(3):275-285.

    • Author

    • StensvÃ¥g K, Haug T, Sperstad SV, Rekdal O, Indrevoll B, Styrvold OB.