General Information

    • DRAMP ID

    • DRAMP02956

    • Peptide Name

    • Dolabellanin B2

    • Source

    • Dolabella auricularia (Sea hare)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SHQDCYEALHKCMASHSKPFSCSMKFHMCLQQQ

    • Sequence Length

    • 33

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis RIMD0225014 (MIC=2.5 µg/ml), Staphylococcus aureus IID1677 (MRSA) (MIC=20.0 µg/ml), Listeria monocytogenes VIU206 (MIC=40.0 µg/ml).
      • Gram-negative bacteria: Haemophilus influenzae IID983 (MIC=5.0 µg/ml), V. vulnificus RIMD2219009 (MIC=5.0 µg/ml), Escherichia coli JM109 (MIC=20.0 µg/ml), E. coli DH5α (MIC=40.0 µg/ml).
      • Fungi: Candida albicans ATCC36232, Candida tropicalis TIMM0313, S. pombe IFO1628, Saccharomyces cerevisiae A581A.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Contains two disulfide bonds. Up to two of the methionines may be oxidized to methionine sulfoxides.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02956 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02956.

Physicochemical Information

    • Formula

    • C163H248N48O48S7

    • Absent Amino Acids

    • GINRTVW

    • Common Amino Acids

    • S

    • Mass

    • 3872.48

    • PI

    • 7.71

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +5

    • Boman Index

    • -58.53

    • Hydrophobicity

    • -0.603

    • Aliphatic Index

    • 29.7

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1740

    • Absorbance 280nm

    • 54.38

    • Polar Residues

    • 10

DRAMP02956

DRAMP02956 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against Gram-negative bacteria and Gram-positive bacteria. Also possesses antifungal activity.

    • PTM

    • Contains two disulfide bonds. Up to two of the methionines may be oxidized to methionine sulfoxides.

Literature Information

  • ·Literature 1

    • Title

    • A novel antimicrobial peptide from the sea hare Dolabella auricularia.

    • Reference

    • Dev. Comp. Immunol. 2003;27:305-311.

    • Author

    • Iijima R, Kisugi J, Yamazaki M.