• DRAMP ID

    • DRAMP02957
    • Peptide Name

    • Liver-expressed antimicrobial protein 2 (pigs, mammals, animals)
    • Source

    • Sus scrofa (Pig)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MWHLKLFAVLVICLLLAVQVHGSPIPELSSAKRRPRRITPFWRAVSLRPIGASCRDDSECLTRLCRKRRCSLSVAQE
    • Sequence Length

    • 77
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02957 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02957.
    • Formula

    • C388H647N121O100S6
    • Absent Amino Acids

    • NY
    • Common Amino Acids

    • LR
    • Mass

    • 8799.52
    • PI

    • 10.73
    • Basic Residues

    • 16
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 31
    • Net Charge

    • +11
    • Boman Index

    • -141.23
    • Hydrophobicity

    • 0.069
    • Aliphatic Index

    • 106.36
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11250
    • Absorbance 280nm

    • 148.03
    • Polar Residues

    • 17

DRAMP02957

DRAMP02957 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Porcine liver-expressed antimicrobial peptides, hepcidin and LEAP-2: cloning and induction by bacterial infection.
    • Reference

    • Dev Comp Immunol. 2006;30(4):357-366.
    • Author

    • Sang Y, Ramanathan B, Minton JE, Ross CR, Blecha F.