General Information

    • DRAMP ID

    • DRAMP02958

    • Peptide Name

    • Cathelin (pigs, mammals, animals)

    • Source

    • Sus scrofa (Pig)

    • Family

    • Belongs to the cathelicidin family

    • Gene

    • Not found

    • Sequence

    • QLRYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKEKQCVGTVTLNPSIHSLDISCNEIQSV

    • Sequence Length

    • 96

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02958 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02958.

Physicochemical Information

    • Formula

    • C470H762N134O152S4

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • LPE

    • Mass

    • 10850.27

    • PI

    • 5.11

    • Basic Residues

    • 13

    • Acidic Residues

    • 15

    • Hydrophobic Residues

    • 27

    • Net Charge

    • -2

    • Boman Index

    • -233.28

    • Hydrophobicity

    • -0.656

    • Aliphatic Index

    • 81.15

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3230

    • Absorbance 280nm

    • 34

    • Polar Residues

    • 25

DRAMP02958

DRAMP02958 chydropathy plot

Comments Information

    • Function

    • Probably a microbicidal peptide.

    • PTM

    • contains two disulfide bonds 55-66; 73-90.

Literature Information

  • ·Literature 1

    • Title

    • Pig leukocyte cysteine proteinase inhibitor (PLCPI), a new member of the stefin family.

    • Reference

    • FEBS Lett. 1993 Dec 27;336(2):289-292.

    • Author

    • Lenarcic B, Ritonja A, Dolenc I, Stoka V, Berbic S, Pungercar J, Strukelj B, Turk V.