General Information

    • DRAMP ID

    • DRAMP02962

    • Peptide Name

    • PMAP-36

    • Source

    • Sus scrofa

    • Family

    • Belongs to the cathelicidin family

    • Gene

    • PMAP36

    • Sequence

    • GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG

    • Sequence Length

    • 36

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.27251456] Gram-positive bacteria: Staphylococcus aureus 29213 (MIC=2 μM, MBC=4 μM), Staphylococcus aureus 25923 (MIC=2 μM, MBC=4 μM), Staphylococcus epidermidis 12228 (MIC=2 μM, MBC=4 μM), Bacillus subtilis 63501 (MIC=1 μM, MBC=1 μM);
      • Gram-negative bacteria: Escherichia coli 25922 (MIC=1 μM, MBC=4 μM), Escherichia coli EC183 (MIC=1 μM, MBC=1 μM), Escherichia coli 1005 (MIC=2 μM, MBC=2 μM), Salmonella typhimurium C77-31 (MIC=1 μM, MBC=2 μM);
      • Fungi: Candida albicans 2.2086 (MIC=128 μM, MFC=128 μM), Candida albicans CA276 (MIC=128 μM, MFC=128 μM), Candida tropicalis 2.1975 (MIC=1 μM, MFC=2 μM), Candida krusei 2.1857 (MIC=8 μM, MFC=8 μM).

    • Hemolytic Activity

      • [Ref.27251456] 5% hemolysis at 4 µM, MHC=4 µM against human red blood cells.

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix

    • Structure Description

    • PMAP-36 contains a typical

    • Helical Wheel Diagram

    • DRAMP02962 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C191H336N62O39S

    • Absent Amino Acids

    • ADEHMNQY

    • Common Amino Acids

    • K

    • Mass

    • 4157.22

    • PI

    • 12.31

    • Basic Residues

    • 13

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +13

    • Boman Index

    • -75.61

    • Hydrophobicity

    • -0.461

    • Aliphatic Index

    • 102.78

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 157.14

    • Polar Residues

    • 8

DRAMP02962

DRAMP02962 chydropathy plot

Comments Information

    • Function

    • Antimicrobial activity against the Gram-negative bacteria, Gram-positive bacteria and Fungi. Has hemolytic activity.

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial activity, improved cell selectivity and mode of action of short PMAP-36-derived peptides against bacteria and Candida.

    • Reference

    • Sci Rep. 2016 Jun 2;6:27258.

    • Author

    • Lyu Y, Yang Y, Lyu X, Dong N, Shan A.