• • DRAMP ID

  • DRAMP02964

• • Peptide Name

  • PMAP-36(1-34)

• • Source

  • Sus scrofa (Pig)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLG

• • Sequence Length

  • 34

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-positive bacteria: Staphylococcus aureus ATCC 25923 (MIC=1 µM), S. aureus 710A (MIC=2 µM), S. aureus SA-62 (MRSA) (MIC=4 µM), Bacillus megaterium Bm11 (MIC=1 µM), S. epidermidis ATCC 12228 (MIC=1 µM);
    • Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=1 µM), E. coli ML35 (MIC=1 µM), E. coli D21 (MIC=1 µM), E. coli D22 (MIC=0.5 µM), S. enterica ser. Typhimurium ATCC 14028 (MIC=1 µM), S. enterica ser. Enteritidis H2 (MIC=1 µM), P. aeruginosa ATCC 27853 (MIC=1 µM), S. marcescens ATCC 8100 (MIC=2 µM).
    • Fungi: Candida albicans c.i. (MIC=8 µM), Cryptococcus neoformans c.i.(MIC=2 µM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP02964_predicted_structure.pdb to download.

DRAMP02964

• • Function

  • Exerts antimicrobial activity against both Gram-positive and negative bacteria.

• ·Literature 1

• • Title

  • Structural aspects and biological properties of the cathelicidin PMAP-36.

• • Pubmed ID

  • 16128809

• • Reference

  • FEBS J. 2005 Sep;272(17):4398-4406.

• • Author

  • Scocchi M, Zelezetsky I, Benincasa M, Gennaro R, Mazzoli A, Tossi A.