General Information

    • DRAMP ID

    • DRAMP02966

    • Peptide Name

    • DBI(32-86) (pigs, mammals, animals)

    • Source

    • Sus scrofa (Pig)

    • Family

    • Belongs to the ACBP family

    • Gene

    • DBI

    • Sequence

    • KQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI

    • Sequence Length

    • 55

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Bacillus megaterium Bm11 (MIC=0.69 µM);
      • Gram-negative bacteria: Escherichia coli D22 (MIC=30 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02966 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02966.

Physicochemical Information

    • Formula

    • C275H449N75O82S

    • Absent Amino Acids

    • CFH

    • Common Amino Acids

    • K

    • Mass

    • 6150.1

    • PI

    • 9.48

    • Basic Residues

    • 12

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +4

    • Boman Index

    • -105.8

    • Hydrophobicity

    • -0.876

    • Aliphatic Index

    • 76.36

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 13980

    • Absorbance 280nm

    • 258.89

    • Polar Residues

    • 15

DRAMP02966

DRAMP02966 chydropathy plot

Comments Information

    • Function

    • DBI(32-86) has antibacterial properties.

Literature Information

  • ·Literature 1

    • Title

    • Isolation of three antibacterial peptides from pig intestine: gastric inhibitory polypeptide (7-42), diazepam-binding inhibitor (32-86) and a novel factor, peptide 3910.

    • Reference

    • Eur J Biochem. 1993 Sep 1;216(2):623-629.

    • Author

    • Agerberth B, Boman A, Andersson M, Jörnvall H, Mutt V, Boman HG.
  • ·Literature 2

    • Title

    • Isolation and characterization of porcine diazepam-binding inhibitor, a polypeptide not only of cerebral occurrence but also common in intestinal tissues and with effects on regulation of insulin release.

    • Reference

    • Eur J Biochem. 1988 Jun 1;174(2):239-245.

    • Author

    • Chen ZW, Agerberth B, Gell K, Andersson M, Mutt V, Ostenson CG, Efendić S, Barros-Söderling J, Persson B, Jörnvall H.