General Information

    • DRAMP ID

    • DRAMP02967

    • Peptide Name

    • Antibacterial peptide 3910 (AP 3910; pigs, mammals, animals)

    • Source

    • Sus scrofa (Pig)

    • Family

    • Belongs to the E(R) family

    • Gene

    • ERH

    • Sequence

    • RADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK

    • Sequence Length

    • 32

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Bacillus megaterium.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02967 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02967.

Physicochemical Information

    • Formula

    • C175H278N52O50

    • Absent Amino Acids

    • CFHMS

    • Common Amino Acids

    • Q

    • Mass

    • 3910.45

    • PI

    • 9.87

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +4

    • Boman Index

    • -98.69

    • Hydrophobicity

    • -1.331

    • Aliphatic Index

    • 67.19

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 9970

    • Absorbance 280nm

    • 321.61

    • Polar Residues

    • 7

DRAMP02967

DRAMP02967 chydropathy plot

Comments Information

    • Function

    • May have a role in the cell cycle (By similarity). AP 3910 has antibacterial activity against B. megaterium.

    • Subunit structure

    • Homodimer (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Isolation of three antibacterial peptides from pig intestine: gastric inhibitory polypeptide (7-42), diazepam-binding inhibitor (32-86) and a novel factor, peptide 3910.

    • Reference

    • Eur J Biochem. 1993 Sep 1;216(2):623-629.

    • Author

    • Agerberth B, Boman A, Andersson M, Jörnvall H, Mutt V, Boman HG.