• DRAMP ID

    • DRAMP02976
    • Peptide Name

    • Beta-defensin 1 (BD-1; Defensin, beta 1; pigs, mammals, animals)
    • Source

    • Sus scrofa (Pig)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB1
    • Sequence

    • NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK
    • Sequence Length

    • 41
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Listeria monocytogenes-
        Streptococcus suis-
        Actinobacillus pleuropneumoniae;-
      • Gram-negative bacterium: Escherichia coli.
      • Yeast: Candida albicans.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02976 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02976.
    • Formula

    • C180H319N59O50S9
    • Absent Amino Acids

    • DEFHWY
    • Common Amino Acids

    • K
    • Mass

    • 4398.42
    • PI

    • 9.82
    • Basic Residues

    • 9
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +9
    • Boman Index

    • -60.94
    • Hydrophobicity

    • -0.366
    • Aliphatic Index

    • 52.2
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 9.38
    • Polar Residues

    • 17

DRAMP02976

DRAMP02976 chydropathy plot
    • Function

    • Has bactericidal activity (By similarity).
    • PTM

    • Contains three disulfide bonds 8-37; 15-30; 20-38 (By similarity).
  • ·Literature 1
    • Title

    • The host defense peptide Beta-defensin 1 confers protection against Bordetella pertussis in newborn piglets.
    • Reference

    • Infect Immun. 2006 Apr;74(4):2338-2352.
    • Author

    • Elahi S, Buchanan RM, Attah-Poku S, Townsend HG, Babiuk LA, Gerdts V.
  • ·Literature 2
    • Title

    • Molecular cloning and tissue expression of porcine beta-defensin-1.
    • Reference

    • FEBS Lett. 1998 Mar 6;424(1-2):37-40.
    • Author

    • Zhang G, Wu H, Shi J, Ganz T, Ross CR, Blecha F.
  • ·Literature 3
    • Title

    • Cloning and characterization of the gene for a new epithelial beta-defensin. Genomic structure, chromosomal localization, and evidence for its constitutive expression.
    • Reference

    • Biol Chem. 1999 Aug 20;274(34):24031-24037.
    • Author

    • Zhang G, Hiraiwa H, Yasue H, Wu H, Ross CR, Troyer D, Blecha F.