General Information

    • DRAMP ID

    • DRAMP02976

    • Peptide Name

    • Beta-defensin 1 (BD-1; Defensin, beta 1; pigs, mammals, animals)

    • Source

    • Sus scrofa (Pig)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB1

    • Sequence

    • NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK

    • Sequence Length

    • 41

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Listeria monocytogenes, Streptococcus suis, Actinobacillus pleuropneumoniae;
      • Gram-negative bacterium: Escherichia coli.
      • Yeast: Candida albicans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02976 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02976.

Physicochemical Information

    • Formula

    • C180H319N59O50S9

    • Absent Amino Acids

    • DEFHWY

    • Common Amino Acids

    • K

    • Mass

    • 4398.42

    • PI

    • 9.82

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +9

    • Boman Index

    • -60.94

    • Hydrophobicity

    • -0.366

    • Aliphatic Index

    • 52.2

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 9.38

    • Polar Residues

    • 17

DRAMP02976

DRAMP02976 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity (By similarity).

    • PTM

    • Contains three disulfide bonds 8-37; 15-30; 20-38 (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The host defense peptide Beta-defensin 1 confers protection against Bordetella pertussis in newborn piglets.

    • Reference

    • Infect Immun. 2006 Apr;74(4):2338-2352.

    • Author

    • Elahi S, Buchanan RM, Attah-Poku S, Townsend HG, Babiuk LA, Gerdts V.
  • ·Literature 2

    • Title

    • Molecular cloning and tissue expression of porcine beta-defensin-1.

    • Reference

    • FEBS Lett. 1998 Mar 6;424(1-2):37-40.

    • Author

    • Zhang G, Wu H, Shi J, Ganz T, Ross CR, Blecha F.
  • ·Literature 3

    • Title

    • Cloning and characterization of the gene for a new epithelial beta-defensin. Genomic structure, chromosomal localization, and evidence for its constitutive expression.

    • Reference

    • Biol Chem. 1999 Aug 20;274(34):24031-24037.

    • Author

    • Zhang G, Hiraiwa H, Yasue H, Wu H, Ross CR, Troyer D, Blecha F.