General Information

    • DRAMP ID

    • DRAMP02977

    • Peptide Name

    • pBD-1 (porcine beta-defensin 1; pigs, mammals, animals)

    • Source

    • Sus scrofa (Pig)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02977 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02977.

Physicochemical Information

    • Formula

    • C164H293N53O44S9

    • Absent Amino Acids

    • DEFHWY

    • Common Amino Acids

    • K

    • Mass

    • 4000

    • PI

    • 9.82

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +9

    • Boman Index

    • -53.52

    • Hydrophobicity

    • -0.327

    • Aliphatic Index

    • 47.3

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 10.42

    • Polar Residues

    • 14

DRAMP02977

DRAMP02977 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • [Expression of porcine beta-defensin 1 gene in Pichia pastoris] In Chinese

    • Reference

    • Sheng Wu Gong Cheng Xue Bao. 2006 Nov;22(6):1036-9.

    • Author

    • Jiang LH, Lu HR, Huang DX, Yi JB, Li LY, Lin F.