• DRAMP ID

    • DRAMP02982
    • Peptide Name

    • Reactive oxygen species modulator 1 (ROS modulator 1; pigs, mammals, animals)
    • Source

    • Sus scrofa (Pig)
    • Family

    • Belongs to the MGR2 family
    • Gene

    • romo1
    • Sequence

    • MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGPFSCLRIGMRGRELMGGIGKTMMQSGGTFGPFMAIGMGIRC
    • Sequence Length

    • 79
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus-
        Mycobacterium tuberculosis;-
      • Gram-negative bacterium: Pseudomonas aeruginosa.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02982 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02982.
    • Formula

    • C355H567N99O94S14
    • Absent Amino Acids

    • HNW
    • Common Amino Acids

    • G
    • Mass

    • 8174.85
    • PI

    • 9.58
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 24
    • Net Charge

    • +5
    • Boman Index

    • -8.75
    • Hydrophobicity

    • 0.487
    • Aliphatic Index

    • 60.51
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1740
    • Absorbance 280nm

    • 22.31
    • Polar Residues

    • 28

DRAMP02982

DRAMP02982 chydropathy plot
    • Function

    • Has antibacterial activity against a variety of bacteria. Acts by inducing bacterial membrane breakage (By similarity).
    • Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation (By similarity).

    • Domain

    • Contains a transmembrane helix.
  • ·Literature 1
    • Title

    • Generation and analysis of cDNA sequences derived from a porcine skeletal muscle library.
    • Reference

    • Submitted (MAY-2006) to the EMBL/GenBank/DDBJ databases
    • Author

    • Cai G, Chen Y, Wang C, Li J, Peng G, Zhang H.