General Information

    • DRAMP ID

    • DRAMP02983

    • Peptide Name

    • Liver-expressed antimicrobial peptide 2 (LEAP-2; pigs, mammals, animals)

    • Source

    • Cavia porcellus (Guinea pig)

    • Family

    • Not found

    • Gene

    • LEAP2

    • Sequence

    • MTPFWRGVSLRPIGASCRDDSECITRLCKKRRCSLSVAQE

    • Sequence Length

    • 40

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02983 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02983.

Physicochemical Information

    • Formula

    • C191H320N62O57S5

    • Absent Amino Acids

    • HNY

    • Common Amino Acids

    • R

    • Mass

    • 4557.32

    • PI

    • 9.3

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +4

    • Boman Index

    • -108.4

    • Hydrophobicity

    • -0.388

    • Aliphatic Index

    • 68.25

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 147.44

    • Polar Residues

    • 13

DRAMP02983

DRAMP02983 chydropathy plot

Comments Information

    • PTM

    • Contains two disulfide bonds 17-28; 23-33.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and biochemical characterization of LEAP-2, a novel blood peptide expressed in the liver.

    • Reference

    • Protein Sci. 2003 Jan;12(1):143-152.

    • Author

    • Krause A, Sillard R, Kleemeier B, Klüver E, Maronde E, Conejo-García JR, Forssmann WG, Schulz-Knappe P, Nehls MC, Wattler F, Wattler S, Adermann K.