General Information

    • DRAMP ID

    • DRAMP02984

    • Peptide Name

    • Neutrophil cationic antibacterial polypeptide of 11 kDa (CAP11; pigs, mammals, animals)

    • Source

    • Cavia porcellus (Domestic guinea pig)

    • Family

    • Not found

    • Gene

    • CAP11

    • Sequence

    • GLRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (ED50=30-35 nM);
      • Gram-positive bacterium: Staphylococcus aureus (ED50=90-120 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02984 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02984.

Physicochemical Information

    • Formula

    • C241H404N80O52S

    • Absent Amino Acids

    • DHMNS

    • Common Amino Acids

    • K

    • Mass

    • 5286.42

    • PI

    • 11.82

    • Basic Residues

    • 17

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +16

    • Boman Index

    • -143.63

    • Hydrophobicity

    • -1.295

    • Aliphatic Index

    • 63.49

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 13980

    • Absorbance 280nm

    • 332.86

    • Polar Residues

    • 10

DRAMP02984

DRAMP02984 chydropathy plot

Comments Information

    • Function

    • Shows antibacterial activity against the Gram-positive bacteium S. aureus and Gram-negative bacterium E. coli.

Literature Information

  • ·Literature 1

    • Title

    • Purification of the 11- and 5-kDa antibacterial polypeptides from guinea pig neutrophils.

    • Reference

    • Arch Biochem Biophys. 1996 Apr 15;328(2):219-226.

    • Author

    • Yomogida S, Nagaoka I, Yamashita T.