General Information

    • DRAMP ID

    • DRAMP02985

    • Peptide Name

    • Neutrophil cationic peptide 2 (CP-2; GNCP-2; pigs, mammals, animals)

    • Source

    • Cavia porcellus (Guinea pig)

    • Family

    • Belongs to the alpha-defensin family

    • Gene

    • Not found

    • Sequence

    • RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC

    • Sequence Length

    • 31

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral

    • Target Organism

      • Gram-negative bacterium: Escherichia coli;
      • Gram-positive bacterium: Staphylococcus aureus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02985 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02985.

Physicochemical Information

    • Formula

    • C164H262N54O41S6

    • Absent Amino Acids

    • ADEHKMSW

    • Common Amino Acids

    • R

    • Mass

    • 3838.58

    • PI

    • 9.8

    • Basic Residues

    • 7

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +7

    • Boman Index

    • -93.39

    • Hydrophobicity

    • -0.223

    • Aliphatic Index

    • 47.1

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 111.83

    • Polar Residues

    • 15

DRAMP02985

DRAMP02985 chydropathy plot

Comments Information

    • Function

    • Has antibiotic, anti-fungi and antiviral activity.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Cloning and characterization of the guinea pig neutrophil cationic peptide-1 and -2 genes.

    • Reference

    • DNA Seq. 1993;4(2):123-128.

    • Author

    • Nagaoka I, Nonoguchi A, Yamashita T.
  • ·Literature 2

    • Title

    • Synergistic actions of antibacterial neutrophil defensins and cathelicidins.

    • Reference

    • Inflamm Res. 2000 Feb;49(2):73-79.

    • Author

    • Nagaoka I, Hirota S, Yomogida S, Ohwada A, Hirata M.