General Information

    • DRAMP ID

    • DRAMP02995

    • Peptide Name

    • Hymenoptaecin (Insects, animals)

    • Source

    • Apis mellifera (Honeybee)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • QERGSIVIQGTKEGKSRPSLDIDYKQRVYDKNGMTGDAYGGLNIRPGQPSRQHAGFEFGKEYKNGFIKGQSEVQRGPGGRLSPYFGINGGFRF

    • Sequence Length

    • 93

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli K514 (MIC=0.5-1 µM), E. coli K514 anaerobic, E. coli NCTC9001 (MIC=1-5 µM), Xanthomonas campestris (MIC=0.5-1 µM), Pseudomonas solanacearum (MIC>10 µM), Erwinia carotovora ssp.(MIC=1-5 µM);
      • Gram-positive bacteria: Micrococcus lysodeikticus (MIC=1-5 µM), Bacillus megaterium (MIC=0.5-1 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02995 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02995.

Physicochemical Information

    • Formula

    • C454H701N137O136S

    • Absent Amino Acids

    • CW

    • Common Amino Acids

    • G

    • Mass

    • 10286.46

    • PI

    • 9.85

    • Basic Residues

    • 16

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 20

    • Net Charge

    • +7

    • Boman Index

    • -226.21

    • Hydrophobicity

    • -0.98

    • Aliphatic Index

    • 49.25

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7450

    • Absorbance 280nm

    • 80.98

    • Polar Residues

    • 35

DRAMP02995

DRAMP02995 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Functional and chemical characterization of Hymenoptaecin, an antibacterial polypeptide that is infection-inducible in the honeybee (Apis mellifera).

    • Reference

    • J Biol Chem. 1993 Apr 5;268(10):7044-7054.

    • Author

    • Casteels P, Ampe C, Jacobs F, Tempst P.