• DRAMP ID

    • DRAMP03006
    • Peptide Name

    • Defensin (Insects, animals)
    • Source

    • Bombus pascuorum (Brown bumblebee)
    • Family

    • Belongs to the invertebrate defensin family (Type 1 subfamily)
    • Gene

    • Not found
    • Sequence

    • VTCDLLSIKGVAEHSACAANCLSMGKAGGRCENGICLCRKTTFKELWDKRF
    • Sequence Length

    • 51
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal
    • Target Organism

      • Gram-negative bacteria: Micrococcus luteus;
      • Gram-negative bacteria: Escherichia coli D22.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03006 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03006.
    • Formula

    • C235H386N70O70S7
    • Absent Amino Acids

    • PQY
    • Common Amino Acids

    • CAGKL
    • Mass

    • 5536.5
    • PI

    • 8.65
    • Basic Residues

    • 9
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +4
    • Boman Index

    • -71.64
    • Hydrophobicity

    • -0.004
    • Aliphatic Index

    • 74.71
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 117.5
    • Polar Residues

    • 19

DRAMP03006

DRAMP03006 chydropathy plot
    • Function

    • Antibacterial peptide against Gram-positive and Gram-negative bacteria and fungi.
    • Induction

    • By bacterial infection.
  • ·Literature 1
    • Title

    • Novel antibacterial peptides isolated from a European bumblebee, Bombus pascuorum (Hymenoptera, Apoidea).
    • Reference

    • Insect Biochem Mol Biol. 1997 May;27(5):413-422.
    • Author

    • Rees JA, Moniatte M, Bulet P.