General Information
-
DRAMP ID
- DRAMP03016
-
Peptide Name
- Defensin-1 (Insects, animals)
-
Source
- Apis mellifera carnica (Carniolan bee)
-
Family
- Belongs to the invertebrate defensin family (Type 1 subfamily)
-
Gene
- Not found
-
Sequence
- VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF
-
Sequence Length
- 51
-
UniProt Entry
- Q5J8R1
-
Protein Existence
- Protein level
Activity Information
-
Biological Activity
- Antimicrobial, Antibacterial
-
Target Organism
- No MICs found in DRAMP database
-
Hemolytic Activity
-
- No hemolysis information or data found in the reference(s) presented in this entry
-
Cytotoxicity
-
- Not included yet
-
Binding Target
- Not found
Structure Information
-
Linear/Cyclic
- Not included yet
-
N-terminal Modification
- Not included yet
-
C-terminal Modification
- Not included yet
-
Nonterminal Modifications and Unusual Amino Acids
- Not included yet
-
Stereochemistry
- Not included yet
-
Structure
- Not found
-
Structure Description
- Not found
-
Helical Wheel Diagram
-
PDB ID
- None
-
Predicted Structure
- There is no predicted structure for DRAMP03016.
Physicochemical Information
-
Formula
- C237H381N69O71S6
Absent Amino Acids
- MPY
Common Amino Acids
- CKGL
Mass
- 5525.41
PI
- 8.64
Basic Residues
- 9
Acidic Residues
- 5
Hydrophobic Residues
- 17
Net Charge
- +4
-
Boman Index
- -74.52
Hydrophobicity
- -0.086
Aliphatic Index
- 70.78
Half Life
-
- Mammalian:100 hour
- Yeast:>20 hour
- E.coli:>10 hour
Extinction Coefficient Cystines
- 5875
Absorbance 280nm
- 117.5
Polar Residues
- 19
DRAMP03016
Comments Information
Function
- Found in royal jelly and in hemolymph, potent antibacterial protein against Gram-positive bacteria at low concentration (By similarity).
Literature Information
- ·Literature 1
-
Title
- Two structurally different defensin genes, one of them encoding a novel defensin isoform, are expressed in honeybee Apis mellifera.
-
Pubmed ID
- 15607651
-
Reference
- Insect Biochem Mol Biol. 2005 Jan;35(1):11-22.
-
Author
- Klaudiny J, Albert S, Bachanová K, Kopernický J, Simúth J.
