General Information

    • DRAMP ID

    • DRAMP03045

    • Peptide Name

    • Defensin-NV (Insects, animals)

    • Source

    • Nasonia vitripennis (Ectoparasitic wasp)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • VTCELLMFGGVVGDSACAANCLSMGKAGGSCNGGLCDCRKTTFKELWDKRFG

    • Sequence Length

    • 52

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • [Ref.20362606]Gram-positive bacteria: Staphylococcus aureus (MIC=0.93 µM), Bacillus cereus (MIC=0.93 µM), B. dysenteriae (MIC=0.46 µM);
      • Gram-negative bacteria: Escherichia coli (MIC=1.86 µM), Pseudomonas aeruginosa (MIC=9.3 µM).
      • Yeast: Candida albicans (MIC=1.86 µM).

    • Hemolytic Activity

      • [Ref.20362606]5% hemolytic activity at 200 μg/ml against rabbit red blood cells

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • There are three disulfide bonds(By similar).

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03045 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03045.

Physicochemical Information

    • Formula

    • C228H365N65O71S8

    • Absent Amino Acids

    • HIPQY

    • Common Amino Acids

    • G

    • Mass

    • 5409.28

    • PI

    • 7.74

    • Basic Residues

    • 6

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +1

    • Boman Index

    • -46.94

    • Hydrophobicity

    • 0.152

    • Aliphatic Index

    • 61.92

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 115.2

    • Polar Residues

    • 23

DRAMP03045

DRAMP03045 chydropathy plot

Comments Information

    • Function

    • Defensin-NV had little hemolytic activity to rabbit red blood cells and has antimicrobial activity against Gram-positive, Gram-negative bacteria, and Fungi.

Literature Information

  • ·Literature 1

    • Title

    • A defensin antimicrobial peptide from the venoms of Nasonia vitripennis.

    • Reference

    • Toxicon. 2010 Aug 1;56(1):101-106.

    • Author

    • Ye J, Zhao H, Wang H, Bian J, Zheng R.