General Information

    • DRAMP ID

    • DRAMP03054

    • Peptide Name

    • PP113 (Insects, animals)

    • Source

    • Pteromalus puparum (wasp)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GKWGWIYITILFADVGGFKSSRHPEERRVQERRFKRITRGPD

    • Sequence Length

    • 42

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus CVCC1882 (MIC=13 µM), Sarcina lutea CVCC1600 (MIC=16.7 µM), Bacillus pumilus CVCC709 (MIC=23.3 µM), Bacillus subtilis CVCC717 (MIC=23.3 µM).
      • Gram-positive bacterium: Escherichia coli CVCC1570 (MIC=16.7 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03054 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03054.

Physicochemical Information

    • Formula

    • C229H355N71O59

    • Absent Amino Acids

    • CMN

    • Common Amino Acids

    • R

    • Mass

    • 5046.78

    • PI

    • 10.87

    • Basic Residues

    • 11

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +6

    • Boman Index

    • -128.45

    • Hydrophobicity

    • -0.912

    • Aliphatic Index

    • 62.62

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 304.63

    • Polar Residues

    • 10

DRAMP03054

DRAMP03054 chydropathy plot

Comments Information

    • Function

    • These peptides have net positive charges and are active against both Gram-negative and -positive bacteria, but are not active against fungi tested. Salt-dependency studies revealed that the biocidal activity of these peptides against E. coli decreased with increasing concentration of NaCl.

Literature Information

  • ·Literature 1

    • Title

    • Novel antimicrobial peptides identified from an endoparasitic wasp cDNA library.

    • Reference

    • J Pept Sci. 2010 Jan;16(1):58-64.

    • Author

    • Shen X, Ye G, Cheng X, Yu C, Yao H, Hu C.