General Information

    • DRAMP ID

    • DRAMP03061

    • Peptide Name

    • S.calcitrans defensin 1 (Smd1; defensins; Insects, animals)

    • Source

    • Stomoxys calcitrans (Stable fly)

    • Family

    • Belongs to the invertebrate defensin family (Type 1 subfamily)

    • Gene

    • SMD1

    • Sequence

    • AAKPMGITCDLLSLWKVGHAACAAHCLVLGDVGGYCTKEGLCVCKE

    • Sequence Length

    • 46

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03061 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03061.

Physicochemical Information

    • Formula

    • C205H333N55O59S7

    • Absent Amino Acids

    • FNQR

    • Common Amino Acids

    • ACGL

    • Mass

    • 4736.65

    • PI

    • 6.9

    • Basic Residues

    • 6

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +2

    • Boman Index

    • 8.2

    • Hydrophobicity

    • 0.596

    • Aliphatic Index

    • 97.61

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 163.67

    • Polar Residues

    • 16

DRAMP03061

DRAMP03061 chydropathy plot

Comments Information

    • Function

    • Antibacterial peptide active mostly against Gram-negative bacteria. Its activity is enhanced by lipopolysaccharide (By similarity).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Midgut-specific immune molecules are produced by the blood-sucking insect Stomoxys calcitrans.

    • Reference

    • Proc Natl Acad Sci U S A. 1997 Oct 14;94(21):11502-11507.

    • Author

    • Lehane MJ, Wu D, Lehane SM.
  • ·Literature 2

    • Title

    • Regulation of midgut defensin production in the blood-sucking insect Stomoxys calcitrans.

    • Reference

    • Insect Mol Biol. 2001 Dec;10(6):561-571.

    • Author

    • Munks RJ, Hamilton JV, Lehane SM, Lehane MJ.