• DRAMP ID

    • DRAMP03061
    • Peptide Name

    • S.calcitrans defensin 1 (Smd1; defensins; Insects, animals)
    • Source

    • Stomoxys calcitrans (Stable fly)
    • Family

    • Belongs to the invertebrate defensin family (Type 1 subfamily)
    • Gene

    • SMD1
    • Sequence

    • AAKPMGITCDLLSLWKVGHAACAAHCLVLGDVGGYCTKEGLCVCKE
    • Sequence Length

    • 46
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03061 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03061.
    • Formula

    • C205H333N55O59S7
    • Absent Amino Acids

    • FNQR
    • Common Amino Acids

    • ACGL
    • Mass

    • 4736.65
    • PI

    • 6.9
    • Basic Residues

    • 6
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 18
    • Net Charge

    • +2
    • Boman Index

    • 8.2
    • Hydrophobicity

    • 0.596
    • Aliphatic Index

    • 97.61
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 163.67
    • Polar Residues

    • 16

DRAMP03061

DRAMP03061 chydropathy plot
    • Function

    • Antibacterial peptide active mostly against Gram-negative bacteria. Its activity is enhanced by lipopolysaccharide (By similarity).
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Midgut-specific immune molecules are produced by the blood-sucking insect Stomoxys calcitrans.
    • Reference

    • Proc Natl Acad Sci U S A. 1997 Oct 14;94(21):11502-11507.
    • Author

    • Lehane MJ, Wu D, Lehane SM.
  • ·Literature 2
    • Title

    • Regulation of midgut defensin production in the blood-sucking insect Stomoxys calcitrans.
    • Reference

    • Insect Mol Biol. 2001 Dec;10(6):561-571.
    • Author

    • Munks RJ, Hamilton JV, Lehane SM, Lehane MJ.