General Information

    • DRAMP ID

    • DRAMP03063

    • Peptide Name

    • Defensin ARD1 (Heliomicin analogs; Insects, animals)

    • Source

    • Archaeoprepona demophon (One-spotted leafwing butterfly)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Candida albicans IHEM 8060 (MIC=6.25 µg/ml), Cryptococcus neoformans A (MIC=12.5 µg/ml), Aspergillus fumigatus GASP4707 (MIC=12.5 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic(CSαβ scaffold (an α-helix linked to a β-she

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys7 and Cys32; Cys18 and Cys40; Cys22 and Cys42.

    • Stereochemistry

    • L

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03063 helical wheel diagram
  • 1OZZ-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP03063.

Physicochemical Information

    • Formula

    • C202H306N62O63S6

    • Absent Amino Acids

    • MPQ

    • Common Amino Acids

    • CG

    • Mass

    • 4803.39

    • PI

    • 8.32

    • Basic Residues

    • 6

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +3

    • Boman Index

    • -73.96

    • Hydrophobicity

    • -0.418

    • Aliphatic Index

    • 44.32

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14355

    • Absorbance 280nm

    • 333.84

    • Polar Residues

    • 24

DRAMP03063

DRAMP03063 chydropathy plot

Comments Information

    • Function

    • Possesses potent anti-fungal activity.

    • PTM

    • Contains three disulfide bonds 7-32; 18-40; 22-42.

Literature Information

  • ·Literature 1

    • Title

    • Lead optimization of antifungal peptides with 3D NMR structures analysis.

    • Reference

    • Protein Sci. 2004 Mar;13(3):703-713.

    • Author

    • Landon C, Barbault F, Legrain M, Menin L, Guenneugues M, Schott V, Vovelle F, Dimarcq JL.