• DRAMP ID

    • DRAMP03069
    • Peptide Name

    • Diptericin (Insects, animals)
    • Source

    • Sarcophaga peregrina (Flesh fly)
    • Family

    • Belongs to the attacin/sarcotoxin-2 family
    • Gene

    • Not found
    • Sequence

    • DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK
    • Sequence Length

    • 37
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • Escherichia coli (MIC=6.25 µg/ml), Shigella sonnei (MIC=12.5 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Free
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03069 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03069.
    • Formula

    • C173H268N50O55
    • Absent Amino Acids

    • CEFMRV
    • Common Amino Acids

    • G
    • Mass

    • 3928.33
    • PI

    • 6.75
    • Basic Residues

    • 4
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +1
    • Boman Index

    • -60.86
    • Hydrophobicity

    • -1.011
    • Aliphatic Index

    • 65.95
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 6990
    • Absorbance 280nm

    • 194.17
    • Polar Residues

    • 14

DRAMP03069

DRAMP03069 chydropathy plot
    • By injury to the body wall of the larva. Expression peaks at 10 hours post-injury and is maintained at this level for at least 3 days.

  • ·Literature 1
    • Title

    • Purification and characterization of a diptericin homologue from Sarcophaga peregrina (flesh fly).
    • Reference

    • Biochem J. 1992 Oct 15;287 (Pt 2):573-578.
    • Author

    • Ishikawa M, Kubo T, Natori S.