General Information

    • DRAMP ID

    • DRAMP03072

    • Peptide Name

    • Diptericin-D (Insects, animals)

    • Source

    • Protophormia terraenovae (Northern blowfly)

    • Family

    • Belongs to the attacin/sarcotoxin-2 family

    • Gene

    • Not found

    • Sequence

    • DEKPKLILPTPAPPNLPQLVGGGGGNRKDGFGVSVDAHQKVWTSDNGRHSIGVTPGYSQHLGGPYGNSRPDYRIGAGYSYNF

    • Sequence Length

    • 82

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03072 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03072.

Physicochemical Information

    • Formula

    • C387H585N113O117

    • Absent Amino Acids

    • CM

    • Common Amino Acids

    • G

    • Mass

    • 8692.59

    • PI

    • 9.11

    • Basic Residues

    • 11

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +5

    • Boman Index

    • -137.52

    • Hydrophobicity

    • -0.761

    • Aliphatic Index

    • 59.39

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12950

    • Absorbance 280nm

    • 159.88

    • Polar Residues

    • 34

DRAMP03072

DRAMP03072 chydropathy plot

Comments Information

    • Function

    • Has activity against E.coli.

    • Induction

    • By bacterial infection.

    • Miscellaneous

    • There seems to be a family of diptericin in protophormia. Diptericin A is the predominant member.

Literature Information

  • ·Literature 1

    • Title

    • Insect immunity. Isolation of cDNA clones corresponding to diptericin, an inducible antibacterial peptide from Phormia terranovae (Diptera). Transcriptional profiles during immunization.

    • Reference

    • Eur J Biochem. 1989 Jun 15;182(2):423-437.

    • Author

    • Reichhart JM, Essrich M, Dimarcq JL, Hoffmann D, Hoffmann JA, Lagueux M.