General Information

    • DRAMP ID

    • DRAMP03075

    • Peptide Name

    • Cecropin-D

    • Source

    • Antheraea pernyi (Chinese oak silk moth)

    • Family

    • Belongs to the cecropin family

    • Gene

    • Not found

    • Sequence

    • WNPFKELERAGQRVRDAIISAGPAVATVAQATALAK

    • Sequence Length

    • 36

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli D21 (MIC=0.37 µM), E. coli D31 (MIC=0.21 µM), Serratia marsescens (MIC=6.1 µM), S. marsescens Strain 122 (MIC=75 µM), Pseudomonas aeruginosa OT97 (MIC>81 µM), Xenorhabdus nematophilus Xn21 (MIC=16 µM);
      • Gram-positive bacteria: Bacillus subtilis Bsll (MIC>81 µM), Bacillus megaterium Bmll (MIC=24 µM), Bacillus thuringiensis Btll (MIC>81 µM), Streptococcus fecalis Ds16 (MIC>81 µM), S. fecalis AD-4 (MIC>81 µM), Micrococcus luteus MI11 (MIC=4 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Amidation

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03075 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C169H277N51O49

    • Absent Amino Acids

    • CHMY

    • Common Amino Acids

    • A

    • Mass

    • 3807.37

    • PI

    • 9.98

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +2

    • Boman Index

    • -49.18

    • Hydrophobicity

    • -0.033

    • Aliphatic Index

    • 92.5

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 157.14

    • Polar Residues

    • 6

DRAMP03075

DRAMP03075 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

    • PTM

    • C-terminal amidation.

Literature Information

  • ·Literature 1

    • Title

    • Insect immunity: isolation and structure of cecropins B and D from pupae of the Chinese oak silk moth, Antheraea pernyi.

    • Reference

    • Eur J Biochem. 1982 Sep;127(1):219-224.

    • Author

    • Qu Z, Steiner H, Engström A, Bennich H, Boman HG.