General Information

    • DRAMP ID

    • DRAMP03078

    • Peptide Name

    • Cecropin-A2 (Insects, animals)

    • Source

    • Drosophila yakuba (Fruit fly)

    • Family

    • Belongs to the cecropin family

    • Gene

    • CecA2

    • Sequence

    • VFVALILAIAIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGIAQQAANVAATAR

    • Sequence Length

    • 55

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03078 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03078.

Physicochemical Information

    • Formula

    • C257H433N77O72

    • Absent Amino Acids

    • CMPY

    • Common Amino Acids

    • A

    • Mass

    • 5753.74

    • PI

    • 10.43

    • Basic Residues

    • 8

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +5

    • Boman Index

    • -38.27

    • Hydrophobicity

    • 0.293

    • Aliphatic Index

    • 119.09

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 101.85

    • Polar Residues

    • 11

DRAMP03078

DRAMP03078 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

    • PTM

    • C-terminal amidation (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Evolutionary history and mechanism of the Drosophila cecropin gene family.

    • Reference

    • Immunogenetics. 1998 May;47(6):417-429.

    • Author

    • Date A, Satta Y, Takahata N, Chigusa SI.