General Information

    • DRAMP ID

    • DRAMP03082

    • Peptide Name

    • Defensin (invertebrate defensin; Insects, animals)

    • Source

    • Aeshna cyanea (Southern hawker dragonfly)

    • Family

    • Belongs to the invertebrate defensin family (Type 2 subfamily)

    • Gene

    • Not found

    • Sequence

    • GFGCPLDQMQCHRHCQTITGRSGGYCSGPLKLTCTCYR

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Micrococcus luteus, A. viriduns, P. acidiluctici, R. meguterium, Streptococcus pyogenes, A. faecalis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03082 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03082.

Physicochemical Information

    • Formula

    • C173H273N55O52S7

    • Absent Amino Acids

    • AENVW

    • Common Amino Acids

    • CG

    • Mass

    • 4179.83

    • PI

    • 8.68

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +5

    • Boman Index

    • -64

    • Hydrophobicity

    • -0.39

    • Aliphatic Index

    • 41.05

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 90.68

    • Polar Residues

    • 20

DRAMP03082

DRAMP03082 chydropathy plot

Comments Information

    • Function

    • Mediates the inducible antibacterial activity in larvae of A. cyanea.

Literature Information

  • ·Literature 1

    • Title

    • A novel insect defensin mediates the inducible antibacterial activity in larvae of the dragonfly Aeschna cyanea (Paleoptera, Odonata).

    • Reference

    • Eur J Biochem. 1992 Nov 1;209(3):977-984.

    • Author

    • Bulet P, Cociancich S, Reuland M, Sauber F, Bischoff R, Hegy G, Van Dorsselaer A, Hetru C, Hoffmann JA.