General Information

    • DRAMP ID

    • DRAMP03087

    • Peptide Name

    • Drosophila diptericin (Insects, animals)

    • Source

    • Drosophila melanogaster (Fruit fly)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DDMTMKPTPPPQYPLNLQGGGGGGSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRFPNF

    • Sequence Length

    • 83

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03087 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03087.

Physicochemical Information

    • Formula

    • C393H566N110O121S2

    • Absent Amino Acids

    • C

    • Common Amino Acids

    • G

    • Mass

    • 8831.6

    • PI

    • 6.28

    • Basic Residues

    • 8

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +2

    • Boman Index

    • -122.75

    • Hydrophobicity

    • -0.884

    • Aliphatic Index

    • 35.18

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 18450

    • Absorbance 280nm

    • 225

    • Polar Residues

    • 39

DRAMP03087

DRAMP03087 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Insect immunity. Characterization of a Drosophila cDNA encoding a novel member of the diptericin family of immune peptides.

    • Reference

    • J Biol Chem. 1990 Dec 25;265(36):22493-8.

    • Author

    • Wicker C, Reichhart JM, Hoffmann D, Hultmark D, Samakovlis C, Hoffmann JA.