General Information

    • DRAMP ID

    • DRAMP03092

    • Peptide Name

    • Drosophila defensin (Insects, animals)

    • Source

    • Drosophila melanogaster (Fruit fly)

    • Family

    • Not found

    • Gene

    • Def

    • Sequence

    • ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN

    • Sequence Length

    • 40

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03092 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03092.

Physicochemical Information

    • Formula

    • C186H285N57O53S6

    • Absent Amino Acids

    • EMPQ

    • Common Amino Acids

    • C

    • Mass

    • 4360.02

    • PI

    • 8.65

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +5

    • Boman Index

    • -48.15

    • Hydrophobicity

    • -0.178

    • Aliphatic Index

    • 56.25

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 329.87

    • Polar Residues

    • 18

DRAMP03092

DRAMP03092 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterization and transcriptional profiles of a Drosophila gene encoding an insect defensin. A study in insect immunity.

    • Reference

    • Eur J Biochem. 1994 Apr 1;221(1):201-219.

    • Author

    • Dimarcq JL, Hoffmann D, Meister M, Bulet P, Lanot R, Reichhart JM, Hoffmann JA.